PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009172.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 263aa    MW: 27406.9 Da    PI: 9.0106
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009172.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.2e-15175219551
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                 +r++r++kNRe+A rsR RK+a+++eLe  v +Le+e  +L   +e+
  Do009172.1 175 QRQKRMIKNRESAARSRDRKQAYVAELESQVTQLEEEQAELL--AEQ 219
                 89************************************9998..444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-9171234IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.461173218IPR004827Basic-leucine zipper domain
PfamPF001701.7E-12174218IPR004827Basic-leucine zipper domain
CDDcd147076.32E-15175206No hitNo description
SuperFamilySSF579591.38E-11175219No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-14176218No hitNo description
PROSITE patternPS000360178193IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MASSRVMASS SPPQPASAGS SSNLARFRSG SGIGSMNMDD IIRNIYGPEA VHAVGGGAAA  60
EPSPAAPAAA HRRTSEEVWK EISAAGGLSV PALPPPPPAT GAGTGARGGG GGAAEMTLED  120
FLARDSSGRA AAAVVEGSMA LGFPVPDGDS AGGVGGVRAS RKRALVDPAD RAVMQRQKRM  180
IKNRESAARS RDRKQAYVAE LESQVTQLEE EQAELLAEQL MEKAVPVIRK KPLQDLRRTN  240
SMEWVGIVRD QEVTPFRIDL LSA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961953.11e-104PREDICTED: G-box-binding factor 4-like
TrEMBLB6TGZ01e-100B6TGZ0_MAIZE; G-box-binding factor 4
STRINGGRMZM2G132868_P011e-100(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.11e-19G-box binding factor 4